SCOPe 2.01: Domain d2z16b_: 2z16 B:

Lineage for d2z16b_ (2z16 B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.95: Influenza virus matrix protein M1 [48144] (1 superfamily)
   multihelical; consists of two different all-alpha subdomains, 4 helices each

4. Superfamily a.95.1: Influenza virus matrix protein M1 [48145] (1 family)
   superficially similar to membrane translocation domains

5. Family a.95.1.1: Influenza virus matrix protein M1 [48146] (2 proteins)

6. Protein automated matches [190930] (2 species)
   not a true protein

7. Species Influenza A virus [TaxId:11320] [188440] (1 PDB entry)

8. Domain d2z16b_: 2z16 B: [170968]
   automated match to d1aa7a_

Details for d2z16b_

PDB Entry: 2z16, 2.02 Å

PDB Description: Crystal structure of Matrix protein 1 from influenza A virus A/crow/Kyoto/T1/2004(H5N1)

PDB Compounds: (B:) matrix protein 1

SCOPe Domain Sequences for d2z16b_:

Sequence, based on SEQRES records:

>d2z16b_ a.95.1.1 (B:) automated matches {Influenza A virus [TaxId: 11320]}
sgmslltevetyvlsiipsgplkaeiaqkledvfagkntdlealmewlktrpilspltkg
ilgfvftltvpserglqrrrfvqnalngngdpnnmdravklykklkreitfhgakevals
ystgalascmgliynrmgtvttevafglvcatceqiadsq

Sequence, based on observed residues (ATOM records):

>d2z16b_ a.95.1.1 (B:) automated matches {Influenza A virus [TaxId: 11320]}
sgmslltevetyvlsiipsgplkaeiaqkledvfagkntdlealmewlktrpilspltkg
ilgfvftltvpseqrrrfvqnalngnmdravklykklkreitfhgakevalsystgalas
cmgliynrtvttevafglvcatceqiadsq

Timeline for d2z16b_:

• d2z16b_ is new in SCOPe 2.01-stable
  
• d2z16b_ appears in SCOPe 2.02
  
• d2z16b_ appears in the current release, SCOPe 2.08, called d2z16b1