Lineage for d2z16b1 (2z16 B:2-158)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2003254Fold a.95: Influenza virus matrix protein M1 [48144] (1 superfamily)
    multihelical; consists of two different all-alpha subdomains, 4 helices each
  4. 2003255Superfamily a.95.1: Influenza virus matrix protein M1 [48145] (1 family) (S)
    superficially similar to membrane translocation domains
    automatically mapped to Pfam PF00598
  5. 2003256Family a.95.1.1: Influenza virus matrix protein M1 [48146] (2 protein domains)
  6. 2003263Protein automated matches [190930] (5 species)
    not a true protein
  7. 2003267Species Influenza A virus [TaxId:11320] [188440] (1 PDB entry)
  8. 2003269Domain d2z16b1: 2z16 B:2-158 [170968]
    Other proteins in same PDB: d2z16a2, d2z16b2
    automated match to d1aa7a_

Details for d2z16b1

PDB Entry: 2z16 (more details), 2.02 Å

PDB Description: Crystal structure of Matrix protein 1 from influenza A virus A/crow/Kyoto/T1/2004(H5N1)
PDB Compounds: (B:) matrix protein 1

SCOPe Domain Sequences for d2z16b1:

Sequence, based on SEQRES records: (download)

>d2z16b1 a.95.1.1 (B:2-158) automated matches {Influenza A virus [TaxId: 11320]}
slltevetyvlsiipsgplkaeiaqkledvfagkntdlealmewlktrpilspltkgilg
fvftltvpserglqrrrfvqnalngngdpnnmdravklykklkreitfhgakevalsyst
galascmgliynrmgtvttevafglvcatceqiadsq

Sequence, based on observed residues (ATOM records): (download)

>d2z16b1 a.95.1.1 (B:2-158) automated matches {Influenza A virus [TaxId: 11320]}
slltevetyvlsiipsgplkaeiaqkledvfagkntdlealmewlktrpilspltkgilg
fvftltvpseqrrrfvqnalngnmdravklykklkreitfhgakevalsystgalascmg
liynrtvttevafglvcatceqiadsq

SCOPe Domain Coordinates for d2z16b1:

Click to download the PDB-style file with coordinates for d2z16b1.
(The format of our PDB-style files is described here.)

Timeline for d2z16b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2z16b2