SCOPe 2.08: Domain d2z16b1: 2z16 B:2-158

Lineage for d2z16b1 (2z16 B:2-158)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.95: Influenza virus matrix protein M1 [48144] (1 superfamily)
   multihelical; consists of two different all-alpha subdomains, 4 helices each

4. Superfamily a.95.1: Influenza virus matrix protein M1 [48145] (1 family)
   superficially similar to membrane translocation domains
   automatically mapped to Pfam PF00598

5. Family a.95.1.1: Influenza virus matrix protein M1 [48146] (2 proteins)

6. Protein automated matches [190930] (4 species)
   not a true protein

7. Species Influenza A virus, different strains [TaxId:11320] [188440] (2 PDB entries)

8. Domain d2z16b1: 2z16 B:2-158 [170968]
   Other proteins in same PDB: d2z16a2, d2z16b2
   automated match to d1aa7a_

Details for d2z16b1

PDB Entry: 2z16, 2.02 Å

PDB Description: Crystal structure of Matrix protein 1 from influenza A virus A/crow/Kyoto/T1/2004(H5N1)

PDB Compounds: (B:) matrix protein 1

SCOPe Domain Sequences for d2z16b1:

Sequence, based on SEQRES records:

>d2z16b1 a.95.1.1 (B:2-158) automated matches {Influenza A virus, different strains [TaxId: 11320]}
slltevetyvlsiipsgplkaeiaqkledvfagkntdlealmewlktrpilspltkgilg
fvftltvpserglqrrrfvqnalngngdpnnmdravklykklkreitfhgakevalsyst
galascmgliynrmgtvttevafglvcatceqiadsq

Sequence, based on observed residues (ATOM records):

>d2z16b1 a.95.1.1 (B:2-158) automated matches {Influenza A virus, different strains [TaxId: 11320]}
slltevetyvlsiipsgplkaeiaqkledvfagkntdlealmewlktrpilspltkgilg
fvftltvpseqrrrfvqnalngnmdravklykklkreitfhgakevalsystgalascmg
liynrtvttevafglvcatceqiadsq

Timeline for d2z16b1:

• d2z16b1 first appeared in SCOPe 2.01, called d2z16b_
  
• d2z16b1 appears in SCOPe 2.07