![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.95: Influenza virus matrix protein M1 [48144] (1 superfamily) multihelical; consists of two different all-alpha subdomains, 4 helices each |
![]() | Superfamily a.95.1: Influenza virus matrix protein M1 [48145] (1 family) ![]() superficially similar to membrane translocation domains automatically mapped to Pfam PF00598 |
![]() | Family a.95.1.1: Influenza virus matrix protein M1 [48146] (2 proteins) |
![]() | Protein automated matches [190930] (4 species) not a true protein |
![]() | Species Influenza A virus, different strains [TaxId:11320] [188440] (2 PDB entries) |
![]() | Domain d2z16a1: 2z16 A:2-158 [170967] Other proteins in same PDB: d2z16a2, d2z16b2 automated match to d1aa7a_ |
PDB Entry: 2z16 (more details), 2.02 Å
SCOPe Domain Sequences for d2z16a1:
Sequence, based on SEQRES records: (download)
>d2z16a1 a.95.1.1 (A:2-158) automated matches {Influenza A virus, different strains [TaxId: 11320]} slltevetyvlsiipsgplkaeiaqkledvfagkntdlealmewlktrpilspltkgilg fvftltvpserglqrrrfvqnalngngdpnnmdravklykklkreitfhgakevalsyst galascmgliynrmgtvttevafglvcatceqiadsq
>d2z16a1 a.95.1.1 (A:2-158) automated matches {Influenza A virus, different strains [TaxId: 11320]} slltevetyvlsiipsgplkaeiaqkledvfagkntdlealmewlktrpilspltkgilg fvftltvpsrrrfvqnalndpnnmdravklykklkreitfhgakevalsystgalascmg liynrmgtvttevafglvcatceqiadsq
Timeline for d2z16a1: