SCOPe 2.06: Domain d2z10a_: 2z10 A:

Lineage for d2z10a_ (2z10 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (42 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:262724] [188269] (2 PDB entries)

8. Domain d2z10a_: 2z10 A: [170965]
   automated match to d1yrea1

Details for d2z10a_

PDB Entry: 2z10, 1.77 Å

PDB Description: Crystal structure of putative acetyltransferase

PDB Compounds: (A:) Ribosomal-protein-alanine acetyltransferase

SCOPe Domain Sequences for d2z10a_:

Sequence; same for both SEQRES and ATOM records:

>d2z10a_ d.108.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 262724]}
mwafperfegrhvrleplalahlpaflrhydpevyrflsrapvapteealrahlegllge
pgrvnwailfgkevagrisviapepehaklelgtmlfkpfwgspankeakylllrhafev
lraervqfkvdlrnersqralealgavregvlrknrrlpdgafrddvvysvlkeewpgvk
arlearly

Timeline for d2z10a_:

• d2z10a_ first appeared in SCOPe 2.01
  
• d2z10a_ appears in SCOPe 2.05
  
• d2z10a_ appears in SCOPe 2.07
  
• d2z10a_ appears in the current release, SCOPe 2.08