Lineage for d2z0xa_ (2z0x A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1216563Fold d.116: YbaK/ProRS associated domain [55825] (1 superfamily)
    core: alpha-beta-alpha-beta(2)-(alpha-beta)2-alpha-beta(2)-alpha-beta; 3 layers; bifurcated mixed sheet
  4. 1216564Superfamily d.116.1: YbaK/ProRS associated domain [55826] (2 families) (S)
  5. 1216582Family d.116.1.0: automated matches [191417] (1 protein)
    not a true family
  6. 1216583Protein automated matches [190578] (4 species)
    not a true protein
  7. 1216588Species Thermus thermophilus [TaxId:274] [187579] (2 PDB entries)
  8. 1216589Domain d2z0xa_: 2z0x A: [170963]
    automated match to d1wdva_
    complexed with 5ca

Details for d2z0xa_

PDB Entry: 2z0x (more details), 1.64 Å

PDB Description: Crystal structure of ProX-CysSA complex from T. thermophilus
PDB Compounds: (A:) Putative uncharacterized protein TTHA1699

SCOPe Domain Sequences for d2z0xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z0xa_ d.116.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 274]}
slspsarrvqgaletrgfghlkvvelpastrtakeaaqavgaevgqivkslvfvgekgay
lflvsgknrldlgkatrlvggplrqatpeevreltgfaiggvppvghntplpayldedll
gypevwaaggtpralfratpkellaltgaqvadlkeg

SCOPe Domain Coordinates for d2z0xa_:

Click to download the PDB-style file with coordinates for d2z0xa_.
(The format of our PDB-style files is described here.)

Timeline for d2z0xa_: