Lineage for d2z0va_ (2z0v A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2737998Fold a.238: BAR/IMD domain-like [116747] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 2737999Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families) (S)
    core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends
  5. 2738000Family a.238.1.1: BAR domain [103658] (4 proteins)
    sensor of membrane curvature
  6. 2738017Protein automated matches [190594] (1 species)
    not a true protein
  7. 2738018Species Human (Homo sapiens) [TaxId:9606] [187606] (5 PDB entries)
  8. 2738024Domain d2z0va_: 2z0v A: [170961]
    automated match to d1x03a1

Details for d2z0va_

PDB Entry: 2z0v (more details), 2.49 Å

PDB Description: Crystal structure of BAR domain of Endophilin-III
PDB Compounds: (A:) SH3-containing GRB2-like protein 3

SCOPe Domain Sequences for d2z0va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z0va_ a.238.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddefldmerkidvtnkvvaeilsktteylqpnpayraklgmlntvskirgqvkttgypqt
egllgdcmlkygkelgedstfgnalievgesmklmaevkdsldinvkqtfidplqllqdk
dlkeighhlkklegrrldydykkkrvgkipdeevrqavekfeeskelaersmfnflendv
eqvsqlavfieaaldyhrqsteilqelqsklqmrisaassvpr

SCOPe Domain Coordinates for d2z0va_:

Click to download the PDB-style file with coordinates for d2z0va_.
(The format of our PDB-style files is described here.)

Timeline for d2z0va_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2z0vb_