Class b: All beta proteins [48724] (178 folds) |
Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
Superfamily b.122.1: PUA domain-like [88697] (14 families) |
Family b.122.1.6: ProFAR isomerase associated domain [117351] (3 proteins) Pfam PF07060; DUF1530 |
Protein automated matches [190883] (1 species) not a true protein |
Species Pyrococcus horikoshii [TaxId:53953] [188267] (1 PDB entry) |
Domain d2z0tb_: 2z0t B: [170958] automated match to d1s04a_ |
PDB Entry: 2z0t (more details), 1.8 Å
SCOPe Domain Sequences for d2z0tb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z0tb_ b.122.1.6 (B:) automated matches {Pyrococcus horikoshii [TaxId: 53953]} mkwemglqeeyielikagkkkiegrlydekrrqikpgdiiifeggklkvkvkgirvyssf kemlekegienvlpgvksieegvkvyrqfydeerekkygvvaieiepi
Timeline for d2z0tb_: