Lineage for d2z0tb_ (2z0t B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 966930Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 966931Superfamily b.122.1: PUA domain-like [88697] (14 families) (S)
  5. 967049Family b.122.1.6: ProFAR isomerase associated domain [117351] (3 proteins)
    Pfam PF07060; DUF1530
  6. 967056Protein automated matches [190883] (1 species)
    not a true protein
  7. 967057Species Pyrococcus horikoshii [TaxId:53953] [188267] (1 PDB entry)
  8. 967059Domain d2z0tb_: 2z0t B: [170958]
    automated match to d1s04a_

Details for d2z0tb_

PDB Entry: 2z0t (more details), 1.8 Å

PDB Description: Crystal structure of hypothetical protein PH0355
PDB Compounds: (B:) Putative uncharacterized protein PH0355

SCOPe Domain Sequences for d2z0tb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z0tb_ b.122.1.6 (B:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
mkwemglqeeyielikagkkkiegrlydekrrqikpgdiiifeggklkvkvkgirvyssf
kemlekegienvlpgvksieegvkvyrqfydeerekkygvvaieiepi

SCOPe Domain Coordinates for d2z0tb_:

Click to download the PDB-style file with coordinates for d2z0tb_.
(The format of our PDB-style files is described here.)

Timeline for d2z0tb_: