| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) 3 helices; irregular array |
Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) ![]() |
| Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins) |
| Protein automated matches [190929] (6 species) not a true protein |
| Species Influenza A virus [TaxId:11320] [188439] (2 PDB entries) |
| Domain d2z0ac_: 2z0a C: [170950] automated match to d1ns1a_ complexed with gly, sin |
PDB Entry: 2z0a (more details), 1.85 Å
SCOPe Domain Sequences for d2z0ac_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z0ac_ a.16.1.1 (C:) automated matches {Influenza A virus [TaxId: 11320]}
gmdpntvssfqvdcflwhvrkrladqelgdapfldrlrrdqkslrgrgntlgldietatr
agkqiverilee
Timeline for d2z0ac_: