Lineage for d2z0ac_ (2z0a C:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725387Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 1725388Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) (S)
  5. 1725389Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins)
  6. 1725398Protein automated matches [190929] (6 species)
    not a true protein
  7. 1725405Species Influenza A virus [TaxId:11320] [188439] (2 PDB entries)
  8. 1725408Domain d2z0ac_: 2z0a C: [170950]
    automated match to d1ns1a_
    complexed with gly, sin

Details for d2z0ac_

PDB Entry: 2z0a (more details), 1.85 Å

PDB Description: Crystal structure of RNA-binding domain of NS1 from influenza A virus A/crow/Kyoto/T1/2004(H5N1)
PDB Compounds: (C:) nonstructural protein 1

SCOPe Domain Sequences for d2z0ac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z0ac_ a.16.1.1 (C:) automated matches {Influenza A virus [TaxId: 11320]}
gmdpntvssfqvdcflwhvrkrladqelgdapfldrlrrdqkslrgrgntlgldietatr
agkqiverilee

SCOPe Domain Coordinates for d2z0ac_:

Click to download the PDB-style file with coordinates for d2z0ac_.
(The format of our PDB-style files is described here.)

Timeline for d2z0ac_: