![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) 3 helices; irregular array |
![]() | Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) ![]() |
![]() | Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins) |
![]() | Protein automated matches [190929] (5 species) not a true protein |
![]() | Species Influenza A virus, different strains [TaxId:11320] [188439] (2 PDB entries) |
![]() | Domain d2z0aa_: 2z0a A: [170948] Other proteins in same PDB: d2z0ac2 automated match to d1ns1a_ complexed with gly, sin |
PDB Entry: 2z0a (more details), 1.85 Å
SCOPe Domain Sequences for d2z0aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z0aa_ a.16.1.1 (A:) automated matches {Influenza A virus, different strains [TaxId: 11320]} mdpntvssfqvdcflwhvrkrladqelgdapfldrlrrdqkslrgrgntlgldietatra gkqiverileee
Timeline for d2z0aa_:
![]() Domains from other chains: (mouse over for more information) d2z0ab_, d2z0ac1, d2z0ac2, d2z0ad_ |