Lineage for d2z0aa_ (2z0a A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697722Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 2697723Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) (S)
  5. 2697724Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins)
  6. 2697747Protein automated matches [190929] (5 species)
    not a true protein
  7. 2697770Species Influenza A virus, different strains [TaxId:11320] [188439] (2 PDB entries)
  8. 2697771Domain d2z0aa_: 2z0a A: [170948]
    Other proteins in same PDB: d2z0ac2
    automated match to d1ns1a_
    complexed with gly, sin

Details for d2z0aa_

PDB Entry: 2z0a (more details), 1.85 Å

PDB Description: Crystal structure of RNA-binding domain of NS1 from influenza A virus A/crow/Kyoto/T1/2004(H5N1)
PDB Compounds: (A:) nonstructural protein 1

SCOPe Domain Sequences for d2z0aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z0aa_ a.16.1.1 (A:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
mdpntvssfqvdcflwhvrkrladqelgdapfldrlrrdqkslrgrgntlgldietatra
gkqiverileee

SCOPe Domain Coordinates for d2z0aa_:

Click to download the PDB-style file with coordinates for d2z0aa_.
(The format of our PDB-style files is described here.)

Timeline for d2z0aa_: