SCOPe 2.05: Domain d2yzhc_: 2yzh C:

Lineage for d2yzhc_ (2yzh C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (147 species)
   not a true protein

7. Species Aquifex aeolicus [TaxId:224324] [188265] (2 PDB entries)

8. Domain d2yzhc_: 2yzh C: [170942]
   automated match to d1psqa_
   complexed with so4

Details for d2yzhc_

PDB Entry: 2yzh, 1.85 Å

PDB Description: Crystal structure of peroxiredoxin-like protein from Aquifex aeolicus

PDB Compounds: (C:) Probable thiol peroxidase

SCOPe Domain Sequences for d2yzhc_:

Sequence; same for both SEQRES and ATOM records:

>d2yzhc_ c.47.1.0 (C:) automated matches {Aquifex aeolicus [TaxId: 224324]}
ghmartvnlkgnpvtlvgpelkvgdrapeavvvtkdlqekivggakdvvqviitvpsldt
pvcetetkkfneimagmegvdvtvvsmdlpfaqkrfcesfniqnvtvasdfryrdmekyg
vligegalkgilaravfiidkegkvayvqlvpeiteepnydevvnkvkel

Timeline for d2yzhc_:

• d2yzhc_ first appeared in SCOPe 2.01
  
• d2yzhc_ appears in SCOPe 2.04
  
• d2yzhc_ is called d2yzhc1 in SCOPe 2.06
  
• d2yzhc_ appears in the current release, SCOPe 2.08, called d2yzhc1