SCOPe 2.06: Domain d2yzhb1: 2yzh B:1-168

Lineage for d2yzhb1 (2yzh B:1-168)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (165 species)
   not a true protein

7. Species Aquifex aeolicus [TaxId:224324] [188265] (2 PDB entries)

8. Domain d2yzhb1: 2yzh B:1-168 [170941]
   Other proteins in same PDB: d2yzha2, d2yzhb2, d2yzhc2, d2yzhd2
   automated match to d1psqa_
   complexed with so4

Details for d2yzhb1

PDB Entry: 2yzh, 1.85 Å

PDB Description: Crystal structure of peroxiredoxin-like protein from Aquifex aeolicus

PDB Compounds: (B:) Probable thiol peroxidase

SCOPe Domain Sequences for d2yzhb1:

Sequence; same for both SEQRES and ATOM records:

>d2yzhb1 c.47.1.0 (B:1-168) automated matches {Aquifex aeolicus [TaxId: 224324]}
martvnlkgnpvtlvgpelkvgdrapeavvvtkdlqekivggakdvvqviitvpsldtpv
cetetkkfneimagmegvdvtvvsmdlpfaqkrfcesfniqnvtvasdfryrdmekygvl
igegalkgilaravfiidkegkvayvqlvpeiteepnydevvnkvkel

Timeline for d2yzhb1:

• d2yzhb1 first appeared in SCOPe 2.01, called d2yzhb_
  
• d2yzhb1 was called d2yzhb_ in SCOPe 2.05
  
• d2yzhb1 appears in SCOPe 2.07
  
• d2yzhb1 appears in the current release, SCOPe 2.08