SCOPe 2.06: Domain d2yyxa_: 2yyx A:

Lineage for d2yyxa_ (2yyx A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins)

6. Protein Cytochrome c3 [48697] (7 species)
   contains four heme groups

7. Species Desulfovibrio vulgaris [TaxId:881] [48699] (18 PDB entries)
   Uniprot P00132

8. Domain d2yyxa_: 2yyx A: [170938]
   automated match to d1it1a_
   complexed with hem; mutant

Details for d2yyxa_

PDB Entry: 2yyx, 1 Å

PDB Description: the y65a mutant of tetraheme cytochrome c3 from desulfovibrio vulgaris miyazaki f

PDB Compounds: (A:) cytochrome c3

SCOPe Domain Sequences for d2yyxa_:

Sequence; same for both SEQRES and ATOM records:

>d2yyxa_ a.138.1.1 (A:) Cytochrome c3 {Desulfovibrio vulgaris [TaxId: 881]}
apkapadglkmdktkqpvvfnhsthkavkcgdchhpvngkedyqkcatagchdnmdkkdk
sakgayhamhdkgtkfkscvgchletagadaakkkeltgckgskchs

Timeline for d2yyxa_:

• d2yyxa_ first appeared in SCOPe 2.01
  
• d2yyxa_ appears in SCOPe 2.05
  
• d2yyxa_ appears in SCOPe 2.07
  
• d2yyxa_ appears in the current release, SCOPe 2.08