Lineage for d2yytc_ (2yyt C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1815757Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 1815849Family c.1.2.3: Decarboxylase [51375] (4 proteins)
  6. 1815989Protein automated matches [190130] (11 species)
    not a true protein
  7. 1816009Species Geobacillus kaustophilus [TaxId:235909] [188260] (2 PDB entries)
  8. 1816014Domain d2yytc_: 2yyt C: [170933]
    automated match to d1dbta_

Details for d2yytc_

PDB Entry: 2yyt (more details), 2.3 Å

PDB Description: Crystal structure of uncharacterized conserved protein from Geobacillus kaustophilus
PDB Compounds: (C:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d2yytc_:

Sequence, based on SEQRES records: (download)

>d2yytc_ c.1.2.3 (C:) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
pfivaldfpskqeverflrpfagtplfvkvgmelyyqegpaivaflkeqghavfldlklh
dipntvkqamkglarvgadlvnvhaaggrrmmeaaiegldagtpsgrmrprciavtqlts
tdermlheelwisrplvetvahyaalakesgldgvvcsaneaafikercgasflavtpgi
rfaddaahdqvrvvtprkaralgsdyivigrsltraadplrtyarlqhewn

Sequence, based on observed residues (ATOM records): (download)

>d2yytc_ c.1.2.3 (C:) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
pfivaldfpskqeverflrpfagtplfvkvgmelyyqegpaivaflkeqghavfldlklh
dipntvkqamkglarvgadlvnvhaaggrrmmeaaiegldagtpsgrmrprciavtqlts
tdermlheelwisrplvetvahyaalakesgldgvvcsaneaafikercgasflavtvtp
rkaralgsdyivigrsltraadplrtyarlqhewn

SCOPe Domain Coordinates for d2yytc_:

Click to download the PDB-style file with coordinates for d2yytc_.
(The format of our PDB-style files is described here.)

Timeline for d2yytc_: