SCOPe 2.07: Domain d2yybb_: 2yyb B:

Lineage for d2yybb_ (2yyb B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.135: NIF3 (NGG1p interacting factor 3)-like [102704] (1 superfamily)
   consist of two intertwined domains; duplication: contains two structural repeats of alpha-beta-(beta-alpha)3 motif with mixed beta-sheet, order: 1432, strand 1 is antiparallel to the rest

4. Superfamily c.135.1: NIF3 (NGG1p interacting factor 3)-like [102705] (2 families)
   di-iron binding protein

5. Family c.135.1.0: automated matches [191472] (1 protein)
   not a true family

6. Protein automated matches [190747] (3 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [188432] (1 PDB entry)

8. Domain d2yybb_: 2yyb B: [170930]
   automated match to d1nmoa_

Details for d2yybb_

PDB Entry: 2yyb, 2.6 Å

PDB Description: Crystal structure of TTHA1606 from Thermus thermophilus HB8

PDB Compounds: (B:) Hypothetical protein TTHA1606

SCOPe Domain Sequences for d2yybb_:

Sequence; same for both SEQRES and ATOM records:

>d2yybb_ c.135.1.0 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mdrdelvryldaylriqdfpqdpslnglqvegkrtvrkvgaavdageaifrkaleeevdf
livhhglfwgkpfpivghhkrrletlfqgginlyaahlpldaheevgnnfvlarelglvd
ltpwdvgvkgrfpqptpllqvadrlgqltgmqplvhqggldhvetvilvsgsgtgllpkv
dadlfvtgepkhsvfhetferglnviyaghydtetfgvkalaahlearfglpwvfldhpt
gl

Timeline for d2yybb_:

• d2yybb_ first appeared in SCOPe 2.01
  
• d2yybb_ appears in SCOPe 2.06
  
• d2yybb_ appears in the current release, SCOPe 2.08