Lineage for d1weta1 (1wet A:3-58)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 47323Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
  4. 47324Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (5 families) (S)
  5. 47418Family a.35.1.5: Bacterial repressors [47438] (3 proteins)
  6. 47437Protein Purine repressor (PurR), N-terminal domain [47439] (1 species)
  7. 47438Species Escherichia coli [TaxId:562] [47440] (21 PDB entries)
  8. 47447Domain d1weta1: 1wet A:3-58 [17093]
    Other proteins in same PDB: d1weta2

Details for d1weta1

PDB Entry: 1wet (more details), 2.6 Å

PDB Description: structure of the purr-guanine-purf operator complex

SCOP Domain Sequences for d1weta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1weta1 a.35.1.5 (A:3-58) Purine repressor (PurR), N-terminal domain {Escherichia coli}
tikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarslkvnh

SCOP Domain Coordinates for d1weta1:

Click to download the PDB-style file with coordinates for d1weta1.
(The format of our PDB-style files is described here.)

Timeline for d1weta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1weta2