| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.135: NIF3 (NGG1p interacting factor 3)-like [102704] (1 superfamily) consist of two intertwined domains; duplication: contains two structural repeats of alpha-beta-(beta-alpha)3 motif with mixed beta-sheet, order: 1432, strand 1 is antiparallel to the rest |
Superfamily c.135.1: NIF3 (NGG1p interacting factor 3)-like [102705] (2 families) ![]() di-iron binding protein |
| Family c.135.1.0: automated matches [191472] (1 protein) not a true family |
| Protein automated matches [190747] (3 species) not a true protein |
| Species Thermus thermophilus HB8 [TaxId:300852] [188432] (1 PDB entry) |
| Domain d2yyba_: 2yyb A: [170929] automated match to d1nmoa_ |
PDB Entry: 2yyb (more details), 2.6 Å
SCOPe Domain Sequences for d2yyba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yyba_ c.135.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mdrdelvryldaylriqdfpqdpslnglqvegkrtvrkvgaavdageaifrkaleeevdf
livhhglfwgkpfpivghhkrrletlfqgginlyaahlpldaheevgnnfvlarelglvd
ltpwdvgvkgrfpqptpllqvadrlgqltgmqplvhqggldhvetvilvsgsgtgllpkv
dadlfvtgepkhsvfhetferglnviyaghydtetfgvkalaahlearfglpwvfldhpt
gl
Timeline for d2yyba_: