Lineage for d2yy6b_ (2yy6 B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1010738Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1010739Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1011283Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 1011284Protein automated matches [190447] (20 species)
    not a true protein
  7. 1011285Species Aquifex aeolicus [TaxId:224324] [188261] (1 PDB entry)
  8. 1011287Domain d2yy6b_: 2yy6 B: [170928]
    automated match to d2hsza1
    complexed with so4

Details for d2yy6b_

PDB Entry: 2yy6 (more details), 2.3 Å

PDB Description: Crystal Structure of the phosphoglycolate phosphatase from Aquifex aeolicus VF5
PDB Compounds: (B:) Phosphoglycolate phosphatase

SCOPe Domain Sequences for d2yy6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yy6b_ c.108.1.0 (B:) automated matches {Aquifex aeolicus [TaxId: 224324]}
mrvilfdldgtlidsakdialalektlkelgleeyypdnvtkyigggvrallekvlkdkf
reeyvevfrkhylenpvvytkpypeipytlealkskgfklavvsnkleelskkildilnl
sgyfdlivggdtfgekkpsptpvlktleilgeepekalivgdtdadieagkragtktala
lwgyvklnsqipdftlsrpsdlvklmdn

SCOPe Domain Coordinates for d2yy6b_:

Click to download the PDB-style file with coordinates for d2yy6b_.
(The format of our PDB-style files is described here.)

Timeline for d2yy6b_: