Lineage for d2yy5c_ (2yy5 C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2106026Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2106027Protein automated matches [190459] (50 species)
    not a true protein
  7. 2106162Species Mycoplasma pneumoniae [TaxId:272634] [188426] (1 PDB entry)
  8. 2106165Domain d2yy5c_: 2yy5 C: [170925]
    automated match to d1i6ka_
    complexed with so4, wsa

Details for d2yy5c_

PDB Entry: 2yy5 (more details), 2.55 Å

PDB Description: Crystal Structure of tryptophanyl-tRNA synthetase from Mycoplasma pneumoniae
PDB Compounds: (C:) Tryptophanyl-tRNA synthetase

SCOPe Domain Sequences for d2yy5c_:

Sequence, based on SEQRES records: (download)

>d2yy5c_ c.26.1.0 (C:) automated matches {Mycoplasma pneumoniae [TaxId: 272634]}
mkraltgiqasgkqhlgnylgvmqslielqeqcqlfvfvadlhsitvdfqpqalkqnnfd
lvrtllavgldpqkaclflqsdllehsmmgylmmvqsnlgelqrmtqfkakkaeqtrnpn
gtlniptglltypalmagdillyqpdivpvgndqkqhleltrdlaqriqkkfklklrlpq
fvqnkdtnrimdlfdptkkmskssknqngviylddpkevvvkkirqattdsfnkirfask
tqpgvtnmltilkallkepvnqsltnqlgndleayfstksyldlknalteatvnllvniq
rkreqisreqvfnclqagknqaqatarttlalfydgfglgsqnik

Sequence, based on observed residues (ATOM records): (download)

>d2yy5c_ c.26.1.0 (C:) automated matches {Mycoplasma pneumoniae [TaxId: 272634]}
mkraltgiqasgkqhlgnylgvmqslielqeqcqlfvfvadlhsitvdfqpqalkqnnfd
lvrtllavgldpqkaclflqsdllehsmmgylmmvqsnlgelqrmtqfkakkalniptgl
ltypalmagdillyqpdivpvgndqkqhleltrdlaqriqkkfklklrlpqfvqnkdtnr
imdlfdptkkmskssknqngviylddpkevvvkkirqattdsfnkirfasktqpgvtnml
tilkallkepvnqsltnqlgndleayfstksyldlknalteatvnllvniqrkreqisre
qvfnclqagknqaqatarttlalfydgfglgsqnik

SCOPe Domain Coordinates for d2yy5c_:

Click to download the PDB-style file with coordinates for d2yy5c_.
(The format of our PDB-style files is described here.)

Timeline for d2yy5c_: