Lineage for d2yy4b_ (2yy4 B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952974Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 952975Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 954798Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (4 proteins)
  6. 954950Protein automated matches [190384] (8 species)
    not a true protein
  7. 954974Species SARS coronavirus [TaxId:227859] [187411] (12 PDB entries)
  8. 954983Domain d2yy4b_: 2yy4 B: [170922]
    automated match to d1uj1b_

Details for d2yy4b_

PDB Entry: 2yy4 (more details), 2.2 Å

PDB Description: crystal structure of ms8104
PDB Compounds: (B:) Replicase polyprotein 1ab

SCOPe Domain Sequences for d2yy4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yy4b_ b.47.1.4 (B:) automated matches {SARS coronavirus [TaxId: 227859]}
sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
spsgvyqcamrpnhtikgsflngsagsvgfnidydcvsfcymhhmelptgvhagtdlegk
fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc
s

SCOPe Domain Coordinates for d2yy4b_:

Click to download the PDB-style file with coordinates for d2yy4b_.
(The format of our PDB-style files is described here.)

Timeline for d2yy4b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2yy4a_