Lineage for d2yxna_ (2yxn A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860046Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2860232Protein Tyrosyl-tRNA synthetase (TyrRS) [52376] (6 species)
  7. 2860242Species Escherichia coli [TaxId:316407] [188087] (3 PDB entries)
  8. 2860244Domain d2yxna_: 2yxn A: [170916]
    automated match to d1tyae_
    complexed with azy

Details for d2yxna_

PDB Entry: 2yxn (more details), 1.8 Å

PDB Description: structual basis of azido-tyrosine recognition by engineered bacterial tyrosyl-trna synthetase
PDB Compounds: (A:) Tyrosyl-tRNA synthetase

SCOPe Domain Sequences for d2yxna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yxna_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Escherichia coli [TaxId: 316407]}
massnlikqlqerglvaqvtdeealaerlaqgpialvcgfdptadslhlghlvpllclkr
fqqaghkpvalvggatgligdpsfkaaerklnteetvqewvdkirkqvapfldfdcgens
aiaannydwfgnmnvltflrdigkhfsvnqminkeavkqrlnredqgisftefsynllqg
ydfaclnkqygvvlciggsdqwgnitsgidltrrlhqnqvfgltvplitkadgtkfgkte
ggavwldpkktspykfyqfwintadadvyrflkfftfmsieeinaleeedknsgkapraq
yvlaeqvtrlvhgeeglqaakr

SCOPe Domain Coordinates for d2yxna_:

Click to download the PDB-style file with coordinates for d2yxna_.
(The format of our PDB-style files is described here.)

Timeline for d2yxna_: