SCOPe 2.08: Domain d2yxma1: 2yxm A:8-94

Lineage for d2yxma1 (2yxm A:8-94)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d2yxma1: 2yxm A:8-94 [170915]
   Other proteins in same PDB: d2yxma2
   automated match to d1pd6a_

Details for d2yxma1

PDB Entry: 2yxm, 1.51 Å

PDB Description: Crystal structure of I-set domain of human Myosin Binding ProteinC

PDB Compounds: (A:) Myosin-binding protein C, slow-type

SCOPe Domain Sequences for d2yxma1:

Sequence; same for both SEQRES and ATOM records:

>d2yxma1 b.1.1.0 (A:8-94) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aafakildpayqvdkggrvrfvveladpklevkwykngqeirpstkyifehkgcqrilfi
nncqmtddseyyvtagdekcstelfvr

Timeline for d2yxma1:

• d2yxma1 first appeared in SCOPe 2.01, called d2yxma_
  
• d2yxma1 appears in SCOPe 2.07