SCOPe 2.08: Domain d2yxjb1: 2yxj B:27-196

Lineage for d2yxjb1 (2yxj B:27-196)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein Apoptosis regulator Bcl-xL [56856] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56857] (51 PDB entries)

8. Domain d2yxjb1: 2yxj B:27-196 [170914]
   Other proteins in same PDB: d2yxjb2
   automated match to d1g5ja_
   complexed with cl, gol, n3c

Details for d2yxjb1

PDB Entry: 2yxj, 2.2 Å

PDB Description: crystal structure of bcl-xl in complex with abt-737

PDB Compounds: (B:) apoptosis regulator bcl-x

SCOPe Domain Sequences for d2yxjb1:

Sequence, based on SEQRES records:

>d2yxjb1 f.1.4.1 (B:27-196) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
fsdveenrteapegteseavkqalreagdefelryrrafsdltsqlhitpgtayqsfeqv
vnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylndhlepwiqeng
gwdtfvelyg

Sequence, based on observed residues (ATOM records):

>d2yxjb1 f.1.4.1 (B:27-196) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
fsdseavkqalreagdefelryrrafsdltsqlhitpgtayqsfeqvvnelfrdgvnwgr
ivaffsfggalcvesvdkemqvlvsriaawmatylndhlepwiqenggwdtfvelyg

Timeline for d2yxjb1:

• d2yxjb1 first appeared in SCOPe 2.01, called d2yxjb_
  
• d2yxjb1 was called d2yxjb_ in SCOPe 2.07