Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) |
Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
Protein automated matches [190689] (81 species) not a true protein |
Species Methanocaldococcus jannaschii [TaxId:243232] [188256] (2 PDB entries) |
Domain d2yxdb_: 2yxd B: [170906] automated match to d1f38a_ complexed with mes, so4 |
PDB Entry: 2yxd (more details), 2.3 Å
SCOPe Domain Sequences for d2yxdb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yxdb_ c.66.1.0 (B:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]} mipdeefirregvpitkeeiravsigklnlnkddvvvdvgcgsggmtveiakrckfvyai dyldgaievtkqnlakfnikncqiikgraedvldklefnkafiggtkniekiieildkkk inhivantivlenaakiinefesrgynvdavnvfisyakkipsghmflaknpitiikavr
Timeline for d2yxdb_: