SCOPe 2.07: Domain d2yxdb_: 2yxd B:

Lineage for d2yxdb_ (2yxd B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (81 species)
   not a true protein

7. Species Methanocaldococcus jannaschii [TaxId:243232] [188256] (2 PDB entries)

8. Domain d2yxdb_: 2yxd B: [170906]
   automated match to d1f38a_
   complexed with mes, so4

Details for d2yxdb_

PDB Entry: 2yxd, 2.3 Å

PDB Description: Crystal Structure of Cobalamin biosynthesis precorrin 8W decarboxylase (cbiT)

PDB Compounds: (B:) Probable cobalt-precorrin-6Y C(15)-methyltransferase [decarboxylating]

SCOPe Domain Sequences for d2yxdb_:

Sequence; same for both SEQRES and ATOM records:

>d2yxdb_ c.66.1.0 (B:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
mipdeefirregvpitkeeiravsigklnlnkddvvvdvgcgsggmtveiakrckfvyai
dyldgaievtkqnlakfnikncqiikgraedvldklefnkafiggtkniekiieildkkk
inhivantivlenaakiinefesrgynvdavnvfisyakkipsghmflaknpitiikavr

Timeline for d2yxdb_:

• d2yxdb_ first appeared in SCOPe 2.01
  
• d2yxdb_ appears in SCOPe 2.06
  
• d2yxdb_ appears in the current release, SCOPe 2.08