Lineage for d2yxca_ (2yxc A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2347197Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 2347198Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2347199Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins)
  6. 2347208Protein Cytochrome c3 [48697] (7 species)
    contains four heme groups
  7. 2347234Species Desulfovibrio vulgaris [TaxId:881] [48699] (18 PDB entries)
    Uniprot P00132
  8. 2347243Domain d2yxca_: 2yxc A: [170904]
    automated match to d1it1a_
    complexed with hem; mutant

Details for d2yxca_

PDB Entry: 2yxc (more details), 1.5 Å

PDB Description: the h25m mutant of tetraheme cytochrome c3 from desulfovibrio vulgaris miyazaki f
PDB Compounds: (A:) cytochrome c3

SCOPe Domain Sequences for d2yxca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yxca_ a.138.1.1 (A:) Cytochrome c3 {Desulfovibrio vulgaris [TaxId: 881]}
apkapadglkmdktkqpvvfnhstmkavkcgdchhpvngkedyqkcatagchdnmdkkdk
sakgyyhamhdkgtkfkscvgchletagadaakkkeltgckgskchs

SCOPe Domain Coordinates for d2yxca_:

Click to download the PDB-style file with coordinates for d2yxca_.
(The format of our PDB-style files is described here.)

Timeline for d2yxca_: