Lineage for d2yx6d_ (2yx6 D:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 995076Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 996747Superfamily c.55.5: Nitrogenase accessory factor-like [53146] (3 families) (S)
  5. 996763Family c.55.5.0: automated matches [191524] (1 protein)
    not a true family
  6. 996764Protein automated matches [190882] (2 species)
    not a true protein
  7. 996767Species Pyrococcus horikoshii [TaxId:70601] [188259] (1 PDB entry)
  8. 996771Domain d2yx6d_: 2yx6 D: [170903]
    automated match to d1t3va_
    complexed with adp

Details for d2yx6d_

PDB Entry: 2yx6 (more details), 2 Å

PDB Description: Crystal structure of PH0822
PDB Compounds: (D:) Hypothetical protein PH0822

SCOPe Domain Sequences for d2yx6d_:

Sequence, based on SEQRES records: (download)

>d2yx6d_ c.55.5.0 (D:) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
mrvaipaeddrgiksnvskhfgrsryfvfvdiegedvknvevvevpfeehgpgdlpnfik
dhgakivltygigrraieyfnslgisvvtgvygrisdvikafiggklkidydwk

Sequence, based on observed residues (ATOM records): (download)

>d2yx6d_ c.55.5.0 (D:) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
mrvaipaeddrgiksnvskhfgrsryfvfvdiegedvknvevvevpfgpgdlpnfikdhg
akivltygigrraieyfnslgisvvtgvygrisdvikafiggklkidydwk

SCOPe Domain Coordinates for d2yx6d_:

Click to download the PDB-style file with coordinates for d2yx6d_.
(The format of our PDB-style files is described here.)

Timeline for d2yx6d_: