Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.5: Nitrogenase accessory factor-like [53146] (3 families) |
Family c.55.5.0: automated matches [191524] (1 protein) not a true family |
Protein automated matches [190882] (2 species) not a true protein |
Species Pyrococcus horikoshii OT3 [TaxId:70601] [188259] (1 PDB entry) |
Domain d2yx6c_: 2yx6 C: [170902] automated match to d1t3va_ complexed with adp |
PDB Entry: 2yx6 (more details), 2 Å
SCOPe Domain Sequences for d2yx6c_:
Sequence, based on SEQRES records: (download)
>d2yx6c_ c.55.5.0 (C:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]} mrvaipaeddrgiksnvskhfgrsryfvfvdiegedvknvevvevpfeehgpgdlpnfik dhgakivltygigrraieyfnslgisvvtgvygrisdvikafiggklkidydwkek
>d2yx6c_ c.55.5.0 (C:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]} mrvaipaeddiksnvskhfgrsryfvfvdiegedvknvevvevpfeehgdlpnfikdhga kivltygigrraieyfnslgisvvtgvygrisdvikafiggklkidydwkek
Timeline for d2yx6c_: