Lineage for d2yx6b_ (2yx6 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2887722Superfamily c.55.5: Nitrogenase accessory factor-like [53146] (3 families) (S)
  5. 2887738Family c.55.5.0: automated matches [191524] (1 protein)
    not a true family
  6. 2887739Protein automated matches [190882] (2 species)
    not a true protein
  7. 2887742Species Pyrococcus horikoshii OT3 [TaxId:70601] [188259] (1 PDB entry)
  8. 2887744Domain d2yx6b_: 2yx6 B: [170901]
    automated match to d1t3va_
    complexed with adp

Details for d2yx6b_

PDB Entry: 2yx6 (more details), 2 Å

PDB Description: Crystal structure of PH0822
PDB Compounds: (B:) Hypothetical protein PH0822

SCOPe Domain Sequences for d2yx6b_:

Sequence, based on SEQRES records: (download)

>d2yx6b_ c.55.5.0 (B:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
mrvaipaeddrgiksnvskhfgrsryfvfvdiegedvknvevvevpfeehgpgdlpnfik
dhgakivltygigrraieyfnslgisvvtgvygrisdvikafiggklkidydwkek

Sequence, based on observed residues (ATOM records): (download)

>d2yx6b_ c.55.5.0 (B:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
mrvaipaeddrgiksnvskhfgrsryfvfvdiegedvknvevvevpfgdlpnfikdhgak
ivltygigrraieyfnslgisvvtgvygrisdvikafiggklkidydwkek

SCOPe Domain Coordinates for d2yx6b_:

Click to download the PDB-style file with coordinates for d2yx6b_.
(The format of our PDB-style files is described here.)

Timeline for d2yx6b_: