SCOPe 2.01: Domain d2yx6a_: 2yx6 A:

Lineage for d2yx6a_ (2yx6 A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.5: Nitrogenase accessory factor-like [53146] (3 families)

5. Family c.55.5.0: automated matches [191524] (1 protein)
   not a true family

6. Protein automated matches [190882] (2 species)
   not a true protein

7. Species Pyrococcus horikoshii [TaxId:70601] [188259] (1 PDB entry)

8. Domain d2yx6a_: 2yx6 A: [170900]
   automated match to d1t3va_
   complexed with adp

Details for d2yx6a_

PDB Entry: 2yx6, 2 Å

PDB Description: Crystal structure of PH0822

PDB Compounds: (A:) Hypothetical protein PH0822

SCOPe Domain Sequences for d2yx6a_:

Sequence, based on SEQRES records:

>d2yx6a_ c.55.5.0 (A:) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
mrvaipaeddrgiksnvskhfgrsryfvfvdiegedvknvevvevpfeehgpgdlpnfik
dhgakivltygigrraieyfnslgisvvtgvygrisdvikafiggklkidydwke

Sequence, based on observed residues (ATOM records):

>d2yx6a_ c.55.5.0 (A:) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
mrvaipaeddrgiksnvskhfgrsryfvfvdiegedvknvevvevpfgdlpnfikdhgak
ivltygigrraieyfnslgisvvtgvygrisdvikafiggklkidydwke

Timeline for d2yx6a_:

• d2yx6a_ is new in SCOPe 2.01-stable
  
• d2yx6a_ appears in SCOPe 2.02
  
• d2yx6a_ appears in the current release, SCOPe 2.08