SCOPe 2.08: Domain d2yx5a_: 2yx5 A:

Lineage for d2yx5a_ (2yx5 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.284: PurS-like [109622] (1 superfamily)
   consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold

4. Superfamily d.284.1: PurS-like [82697] (3 families)
   segment-swapped dimer: the swapped segment is made of the first helix and second strand; a single long strand is formed by strands 2 and 3 of each subunit

5. Family d.284.1.0: automated matches [191523] (1 protein)
   not a true family

6. Protein automated matches [190881] (2 species)
   not a true protein

7. Species Methanocaldococcus jannaschii [TaxId:2190] [188257] (1 PDB entry)

8. Domain d2yx5a_: 2yx5 A: [170899]
   automated match to d1gtda_

Details for d2yx5a_

PDB Entry: 2yx5, 2.3 Å

PDB Description: Crystal Structure of Methanocaldococcus jannaschii PurS, One of the Subunits of Formylglycinamide Ribonucleotide Amidotransferase in the Purine Biosynthetic Pathway

PDB Compounds: (A:) UPF0062 protein MJ1593

SCOPe Domain Sequences for d2yx5a_:

Sequence, based on SEQRES records:

>d2yx5a_ d.284.1.0 (A:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
mykatviiklkkgvlnpegrtiqralnflgfnnvkevqtykmidiimegeneekvkeeve
emckkllanpvihdyeikvekie

Sequence, based on observed residues (ATOM records):

>d2yx5a_ d.284.1.0 (A:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
mykatviiklkkgvlnpegrtiqralnflgfnnvkevqtykmidiimeeneekvkeevee
mckkllanpvihdyeikvekie

Timeline for d2yx5a_:

• d2yx5a_ first appeared in SCOPe 2.01
  
• d2yx5a_ appears in SCOPe 2.07