Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.284: PurS-like [109622] (1 superfamily) consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold |
Superfamily d.284.1: PurS-like [82697] (3 families) segment-swapped dimer: the swapped segment is made of the first helix and second strand; a single long strand is formed by strands 2 and 3 of each subunit |
Family d.284.1.0: automated matches [191523] (1 protein) not a true family |
Protein automated matches [190881] (2 species) not a true protein |
Species Methanocaldococcus jannaschii [TaxId:2190] [188257] (1 PDB entry) |
Domain d2yx5a_: 2yx5 A: [170899] automated match to d1gtda_ |
PDB Entry: 2yx5 (more details), 2.3 Å
SCOPe Domain Sequences for d2yx5a_:
Sequence, based on SEQRES records: (download)
>d2yx5a_ d.284.1.0 (A:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]} mykatviiklkkgvlnpegrtiqralnflgfnnvkevqtykmidiimegeneekvkeeve emckkllanpvihdyeikvekie
>d2yx5a_ d.284.1.0 (A:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]} mykatviiklkkgvlnpegrtiqralnflgfnnvkevqtykmidiimeeneekvkeevee mckkllanpvihdyeikvekie
Timeline for d2yx5a_: