Lineage for d2ywyc_ (2ywy C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2745461Species Spotted wobbegong (Orectolobus maculatus) [TaxId:168098] [187564] (9 PDB entries)
  8. 2745473Domain d2ywyc_: 2ywy C: [170896]
    automated match to d1vesa_

Details for d2ywyc_

PDB Entry: 2ywy (more details), 2.71 Å

PDB Description: Structure of new antigen receptor variable domain from sharks
PDB Compounds: (C:) new antigen receptor variable domain

SCOPe Domain Sequences for d2ywyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ywyc_ b.1.1.1 (C:) automated matches {Spotted wobbegong (Orectolobus maculatus) [TaxId: 168098]}
awvdqtprsvtketgesltincalknaaddlertdwyrttlgstneqkisiggryvetvn
kgsksfslrirdlrvedsgtykcgayfsdamsnysypipgekgagtvltvkaa

SCOPe Domain Coordinates for d2ywyc_:

Click to download the PDB-style file with coordinates for d2ywyc_.
(The format of our PDB-style files is described here.)

Timeline for d2ywyc_: