| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (24 species) not a true protein |
| Species Spotted wobbegong (Orectolobus maculatus) [TaxId:168098] [187564] (9 PDB entries) |
| Domain d2ywyc_: 2ywy C: [170896] automated match to d1vesa_ |
PDB Entry: 2ywy (more details), 2.71 Å
SCOPe Domain Sequences for d2ywyc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ywyc_ b.1.1.1 (C:) automated matches {Spotted wobbegong (Orectolobus maculatus) [TaxId: 168098]}
awvdqtprsvtketgesltincalknaaddlertdwyrttlgstneqkisiggryvetvn
kgsksfslrirdlrvedsgtykcgayfsdamsnysypipgekgagtvltvkaa
Timeline for d2ywyc_: