SCOPe 2.08: Domain d2ywyb_: 2ywy B:

Lineage for d2ywyb_ (2ywy B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Spotted wobbegong (Orectolobus maculatus) [TaxId:168098] [187564] (9 PDB entries)

8. Domain d2ywyb_: 2ywy B: [170895]
   automated match to d1vesa_

Details for d2ywyb_

PDB Entry: 2ywy, 2.71 Å

PDB Description: Structure of new antigen receptor variable domain from sharks

PDB Compounds: (B:) new antigen receptor variable domain

SCOPe Domain Sequences for d2ywyb_:

Sequence, based on SEQRES records:

>d2ywyb_ b.1.1.1 (B:) automated matches {Spotted wobbegong (Orectolobus maculatus) [TaxId: 168098]}
awvdqtprsvtketgesltincalknaaddlertdwyrttlgstneqkisiggryvetvn
kgsksfslrirdlrvedsgtykcgayfsdamsnysypipgekgagtvltvkaa

Sequence, based on observed residues (ATOM records):

>d2ywyb_ b.1.1.1 (B:) automated matches {Spotted wobbegong (Orectolobus maculatus) [TaxId: 168098]}
awvdqtprsvtketgesltincalknaaddlertdwyrttlgstneqkisiggryvetvn
kgsksfslrirdlrvedsgtykcgayfspgekgagtvltvkaa

Timeline for d2ywyb_:

• d2ywyb_ first appeared in SCOPe 2.01
  
• d2ywyb_ appears in SCOPe 2.07