SCOPe 2.04: Domain d2ywya_: 2ywy A:

Lineage for d2ywya_ (2ywy A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (19 species)
   not a true protein

7. Species Spotted wobbegong (Orectolobus maculatus) [TaxId:168098] [187564] (5 PDB entries)

8. Domain d2ywya_: 2ywy A: [170894]
   automated match to d1vesa_

Details for d2ywya_

PDB Entry: 2ywy, 2.71 Å

PDB Description: Structure of new antigen receptor variable domain from sharks

PDB Compounds: (A:) new antigen receptor variable domain

SCOPe Domain Sequences for d2ywya_:

Sequence; same for both SEQRES and ATOM records:

>d2ywya_ b.1.1.1 (A:) automated matches {Spotted wobbegong (Orectolobus maculatus) [TaxId: 168098]}
awvdqtprsvtketgesltincalknaaddlertdwyrttlgstneqkisiggryvetvn
kgsksfslrirdlrvedsgtykcgayfsdamsnysypipgekgagtvltvkaa

Timeline for d2ywya_:

• d2ywya_ first appeared in SCOPe 2.01
  
• d2ywya_ appears in SCOPe 2.03
  
• d2ywya_ appears in SCOPe 2.05
  
• d2ywya_ appears in the current release, SCOPe 2.08