SCOPe 2.08: Domain d2ywka1: 2ywk A:5-82

Lineage for d2ywka1 (2ywk A:5-82)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188315] (106 PDB entries)

8. Domain d2ywka1: 2ywk A:5-82 [170890]
   Other proteins in same PDB: d2ywka2
   automated match to d1x5ua1

Details for d2ywka1

PDB Entry: 2ywk, 1.54 Å

PDB Description: crystal structure of rrm-domain derived from human putative rna- binding protein 11

PDB Compounds: (A:) Putative RNA-binding protein 11

SCOPe Domain Sequences for d2ywka1:

Sequence; same for both SEQRES and ATOM records:

>d2ywka1 d.58.7.0 (A:5-82) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qeeadrtvfvgnlearvreeilyelflqagpltkvtickdregkpksfgfvcfkhpesvs
yaiallngirlygrpinv

Timeline for d2ywka1:

• d2ywka1 first appeared in SCOPe 2.01, called d2ywka_
  
• d2ywka1 appears in SCOPe 2.07