SCOPe 2.04: Domain d2ywja_: 2ywj A:

Lineage for d2ywja_ (2ywj A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.0: automated matches [191336] (1 protein)
   not a true family

6. Protein automated matches [190197] (15 species)
   not a true protein

7. Species Methanocaldococcus jannaschii [TaxId:243232] [188241] (1 PDB entry)

8. Domain d2ywja_: 2ywj A: [170889]
   automated match to d1q7ra_

Details for d2ywja_

PDB Entry: 2ywj, 1.9 Å

PDB Description: Crystal structure of uncharacterized conserved protein from Methanocaldococcus jannaschii

PDB Compounds: (A:) Glutamine amidotransferase subunit pdxT

SCOPe Domain Sequences for d2ywja_:

Sequence; same for both SEQRES and ATOM records:

>d2ywja_ c.23.16.0 (A:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
miigvlaiqgdveeheeaikkagyeakkvkrvedlegidaliipggestaigklmkkygl
lekiknsnlpilgtcagmvllskgtginqillelmditvkrnaygrqvdsfekeiefkdl
gkvygvfirapvvdkilsddveviardgdkivgvkqgkymalsfhpelsedgykvykyfv
encvk

Timeline for d2ywja_:

• d2ywja_ first appeared in SCOPe 2.01
  
• d2ywja_ appears in SCOPe 2.03
  
• d2ywja_ appears in SCOPe 2.05
  
• d2ywja_ appears in the current release, SCOPe 2.08