SCOPe 2.05: Domain d2yvlc_: 2yvl C:

Lineage for d2yvlc_ (2yvl C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (49 species)
   not a true protein

7. Species Aquifex aeolicus [TaxId:224324] [188415] (4 PDB entries)

8. Domain d2yvlc_: 2yvl C: [170886]
   automated match to d1o54a_
   complexed with sam

Details for d2yvlc_

PDB Entry: 2yvl, 2.2 Å

PDB Description: Crystal structure of tRNA (m1A58) methyltransferase TrmI from Aquifex aeolicus

PDB Compounds: (C:) hypothetical protein

SCOPe Domain Sequences for d2yvlc_:

Sequence; same for both SEQRES and ATOM records:

>d2yvlc_ c.66.1.0 (C:) automated matches {Aquifex aeolicus [TaxId: 224324]}
nsfkegeyvlirfgekkflrkllpkqslsvkksvlkfdevigkpegvkingfevyrptle
eiillgferktqiiypkdsfyialklnlnkekrvlefgtgsgallavlsevagevwtfea
veefyktaqknlkkfnlgknvkffnvdfkdaevpegifhaafvdvrepwhylekvhkslm
egapvgfllptanqvikllesienyfgnlevveilhrhyktiserfrpedqmvahtaylv
fgrklkt

Timeline for d2yvlc_:

• d2yvlc_ first appeared in SCOPe 2.01
  
• d2yvlc_ appears in SCOPe 2.04
  
• d2yvlc_ appears in SCOPe 2.06
  
• d2yvlc_ appears in the current release, SCOPe 2.08