Lineage for d2yvjb_ (2yvj B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782333Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 2782334Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 2782335Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)
  6. 2782420Protein automated matches [190874] (7 species)
    not a true protein
  7. 2782451Species Pseudomonas sp. [TaxId:306] [188227] (3 PDB entries)
  8. 2782454Domain d2yvjb_: 2yvj B: [170883]
    Other proteins in same PDB: d2yvja1, d2yvja2, d2yvja3, d2yvja4, d2yvjp1, d2yvjp2, d2yvjp3, d2yvjp4
    automated match to d1fqta_
    complexed with fad, fes, nai

Details for d2yvjb_

PDB Entry: 2yvj (more details), 1.9 Å

PDB Description: Crystal structure of the ferredoxin-ferredoxin reductase (BPHA3-BPHA4)complex
PDB Compounds: (B:) Biphenyl dioxygenase ferredoxin subunit

SCOPe Domain Sequences for d2yvjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yvjb_ b.33.1.1 (B:) automated matches {Pseudomonas sp. [TaxId: 306]}
tftkacsvdevppgealqvshdaqkvaifnvdgeffatqdqcthgewslseggyldgdvv
ecslhmgkfcvrtgkvkspppceplkvypiriegrdvlvdfsraal

SCOPe Domain Coordinates for d2yvjb_:

Click to download the PDB-style file with coordinates for d2yvjb_.
(The format of our PDB-style files is described here.)

Timeline for d2yvjb_: