![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.80: SIS domain [53696] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345 |
![]() | Superfamily c.80.1: SIS domain [53697] (4 families) ![]() |
![]() | Family c.80.1.3: mono-SIS domain [69599] (6 proteins) dimer of mono-domain subunits |
![]() | Protein automated matches [190898] (4 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [188327] (1 PDB entry) |
![]() | Domain d2yvab_: 2yva B: [170882] automated match to d1x92a_ |
PDB Entry: 2yva (more details), 1.85 Å
SCOPe Domain Sequences for d2yvab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yvab_ c.80.1.3 (B:) automated matches {Escherichia coli [TaxId: 562]} mqerikacftesiqtqiaaaealpdaisraamtlvqsllngnkilccgngtsaanaqhfa asminrfeterpslpaialntdnvvltaiandrlhdevyakqvralghagdvllaistrg nsrdivkaveaavtrdmtivaltgydggelagllgpqdveiripshrsariqemhmltvn clcdlidntlfph
Timeline for d2yvab_: