Lineage for d2yvab_ (2yva B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2908082Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2908083Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2908254Family c.80.1.3: mono-SIS domain [69599] (6 proteins)
    dimer of mono-domain subunits
  6. 2908290Protein automated matches [190898] (4 species)
    not a true protein
  7. 2908293Species Escherichia coli [TaxId:562] [188327] (1 PDB entry)
  8. 2908295Domain d2yvab_: 2yva B: [170882]
    automated match to d1x92a_

Details for d2yvab_

PDB Entry: 2yva (more details), 1.85 Å

PDB Description: Crystal structure of Escherichia coli DiaA
PDB Compounds: (B:) DnaA initiator-associating protein diaA

SCOPe Domain Sequences for d2yvab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yvab_ c.80.1.3 (B:) automated matches {Escherichia coli [TaxId: 562]}
mqerikacftesiqtqiaaaealpdaisraamtlvqsllngnkilccgngtsaanaqhfa
asminrfeterpslpaialntdnvvltaiandrlhdevyakqvralghagdvllaistrg
nsrdivkaveaavtrdmtivaltgydggelagllgpqdveiripshrsariqemhmltvn
clcdlidntlfph

SCOPe Domain Coordinates for d2yvab_:

Click to download the PDB-style file with coordinates for d2yvab_.
(The format of our PDB-style files is described here.)

Timeline for d2yvab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2yvaa_