SCOPe 2.07: Domain d2yv0x_: 2yv0 X:

Lineage for d2yv0x_ (2yv0 X:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (5 protein domains)

6. Protein BH0863-like Ribonuclease H [142490] (3 species)
   new class of RNase H

7. Species Escherichia coli [TaxId:562] [190024] (1 PDB entry)

8. Domain d2yv0x_: 2yv0 X: [170880]
   automated match to d1rbra_
   mutant

Details for d2yv0x_

PDB Entry: 2yv0, 1.4 Å

PDB Description: Structural and Thermodynamic Analyses of E. coli ribonuclease HI Variant with Quintuple Thermostabilizing Mutations

PDB Compounds: (X:) ribonuclease hi

SCOPe Domain Sequences for d2yv0x_:

Sequence; same for both SEQRES and ATOM records:

>d2yv0x_ c.55.3.1 (X:) BH0863-like Ribonuclease H {Escherichia coli [TaxId: 562]}
mlkqveiftdgsclgnpgpggyaailryrgrektfsagytrttnnrmelmaaivalealk
epcevilstdsqylrqgitqwihnwkkrgwktadgkpvknvdlwqrldaalgqhqikwew
vkghaghpenerchelaraaamnptledtgyqvev

Timeline for d2yv0x_:

• d2yv0x_ first appeared in SCOPe 2.01
  
• d2yv0x_ appears in SCOPe 2.06