Lineage for d2yv0x_ (2yv0 X:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2885834Family c.55.3.1: Ribonuclease H [53099] (5 proteins)
  6. 2885835Protein BH0863-like Ribonuclease H [142490] (3 species)
    new class of RNase H
  7. 2885866Species Escherichia coli [TaxId:562] [190024] (1 PDB entry)
  8. 2885867Domain d2yv0x_: 2yv0 X: [170880]
    automated match to d1rbra_
    mutant

Details for d2yv0x_

PDB Entry: 2yv0 (more details), 1.4 Å

PDB Description: structural and thermodynamic analyses of e. coli ribonuclease hi variant with quintuple thermostabilizing mutations
PDB Compounds: (X:) ribonuclease hi

SCOPe Domain Sequences for d2yv0x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yv0x_ c.55.3.1 (X:) BH0863-like Ribonuclease H {Escherichia coli [TaxId: 562]}
mlkqveiftdgsclgnpgpggyaailryrgrektfsagytrttnnrmelmaaivalealk
epcevilstdsqylrqgitqwihnwkkrgwktadgkpvknvdlwqrldaalgqhqikwew
vkghaghpenerchelaraaamnptledtgyqvev

SCOPe Domain Coordinates for d2yv0x_:

Click to download the PDB-style file with coordinates for d2yv0x_.
(The format of our PDB-style files is described here.)

Timeline for d2yv0x_: