SCOPe 2.05: Domain d2puga1: 2pug A:3-58

Lineage for d2puga1 (2pug A:3-58)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (4 proteins)
   lacks the first helix of canonical fold
   3 helices; bundle, partly opened, right-handed twist

6. Protein Purine repressor (PurR), N-terminal domain [47439] (1 species)

7. Species Escherichia coli [TaxId:562] [47440] (24 PDB entries)

8. Domain d2puga1: 2pug A:3-58 [17088]
   Other proteins in same PDB: d2puga2
   protein/DNA complex; complexed with hpa

Details for d2puga1

PDB Entry: 2pug, 2.7 Å

PDB Description: crystal structure of the laci family member, purr, bound to dna: minor groove binding by alpha helices

PDB Compounds: (A:) protein (purine repressor)

SCOPe Domain Sequences for d2puga1:

Sequence; same for both SEQRES and ATOM records:

>d2puga1 a.35.1.5 (A:3-58) Purine repressor (PurR), N-terminal domain {Escherichia coli [TaxId: 562]}
tikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarslkvnh

Timeline for d2puga1:

• d2puga1 first appeared (with stable ids) in SCOP 1.55
  
• d2puga1 appears in SCOPe 2.04
  
• d2puga1 appears in SCOPe 2.06
  
• d2puga1 appears in the current release, SCOPe 2.08