Lineage for d2yrso_ (2yrs O:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688401Protein automated matches [190359] (43 species)
    not a true protein
  7. 2688692Species Human (Homo sapiens) [TaxId:9606] [188371] (10 PDB entries)
  8. 2688702Domain d2yrso_: 2yrs O: [170879]
    Other proteins in same PDB: d2yrsa_, d2yrsc_, d2yrsi_, d2yrsm_
    automated match to d1dxtb_
    complexed with hem

Details for d2yrso_

PDB Entry: 2yrs (more details), 2.3 Å

PDB Description: Human hemoglobin D Los Angeles: crystal structure
PDB Compounds: (O:) Hemoglobin subunit beta

SCOPe Domain Sequences for d2yrso_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yrso_ a.1.1.2 (O:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
qftppvqaayqkvvagvanalahkyh

SCOPe Domain Coordinates for d2yrso_:

Click to download the PDB-style file with coordinates for d2yrso_.
(The format of our PDB-style files is described here.)

Timeline for d2yrso_: