![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein automated matches [190359] (44 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188371] (10 PDB entries) |
![]() | Domain d2yrsb_: 2yrs B: [170873] Other proteins in same PDB: d2yrsa_, d2yrsc_, d2yrsi_, d2yrsm_ automated match to d1dxtb_ complexed with hem |
PDB Entry: 2yrs (more details), 2.3 Å
SCOPe Domain Sequences for d2yrsb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yrsb_ a.1.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk qftppvqaayqkvvagvanalahkyh
Timeline for d2yrsb_: