![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
![]() | Protein automated matches [190115] (94 species) not a true protein |
![]() | Species Geobacillus kaustophilus [TaxId:235909] [188221] (1 PDB entry) |
![]() | Domain d2yr1b_: 2yr1 B: [170871] automated match to d1gqna_ |
PDB Entry: 2yr1 (more details), 2 Å
SCOPe Domain Sequences for d2yr1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yr1b_ c.1.10.0 (B:) automated matches {Geobacillus kaustophilus [TaxId: 235909]} mnispkaikvrniwiggtepcicapvvgeddrkvlreaeevcrkqpdllewradffraid dqervlatanglrniageipilftirsereggqpiplneaevrrlieaicrsgaidlvdy elaygeriadvrrmteecsvwlvvsrhyfdgtprketlladmrqaerygadiakvavmpk spedvlvllqateearrelaiplitmamgglgaitrlagwlfgsavtfavgnqssapgqi piddvrtvlsilqtysr
Timeline for d2yr1b_: