SCOPe 2.01: Domain d2yr1a_: 2yr1 A:

Lineage for d2yr1a_ (2yr1 A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (26 species)
   not a true protein

7. Species Geobacillus kaustophilus [TaxId:235909] [188221] (1 PDB entry)

8. Domain d2yr1a_: 2yr1 A: [170870]
   automated match to d1gqna_

Details for d2yr1a_

PDB Entry: 2yr1, 2 Å

PDB Description: Crystal Structure of 3-dehydroquinate dehydratase from Geobacillus kaustophilus HTA426

PDB Compounds: (A:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d2yr1a_:

Sequence; same for both SEQRES and ATOM records:

>d2yr1a_ c.1.10.0 (A:) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
mnispkaikvrniwiggtepcicapvvgeddrkvlreaeevcrkqpdllewradffraid
dqervlatanglrniageipilftirsereggqpiplneaevrrlieaicrsgaidlvdy
elaygeriadvrrmteecsvwlvvsrhyfdgtprketlladmrqaerygadiakvavmpk
spedvlvllqateearrelaiplitmamgglgaitrlagwlfgsavtfavgnqssapgqi
piddvrtvlsilqtysr

Timeline for d2yr1a_:

• d2yr1a_ is new in SCOPe 2.01-stable
  
• d2yr1a_ appears in SCOPe 2.02
  
• d2yr1a_ appears in the current release, SCOPe 2.08