Lineage for d2yqca_ (2yqc A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133953Family c.68.1.0: automated matches [191551] (1 protein)
    not a true family
  6. 2133954Protein automated matches [190951] (26 species)
    not a true protein
  7. 2134055Species Yeast (Candida albicans) [TaxId:5476] [188550] (4 PDB entries)
  8. 2134056Domain d2yqca_: 2yqc A: [170864]
    automated match to d1jv1a_
    complexed with gol, mg

Details for d2yqca_

PDB Entry: 2yqc (more details), 1.9 Å

PDB Description: Crystal Structure of uridine-diphospho-N-acetylglucosamine pyrophosphorylase from Candida albicans, in the apo-like form
PDB Compounds: (A:) udp-n-acetylglucosamine pyrophosphorylase

SCOPe Domain Sequences for d2yqca_:

Sequence, based on SEQRES records: (download)

>d2yqca_ c.68.1.0 (A:) automated matches {Yeast (Candida albicans) [TaxId: 5476]}
vksqqqiidsfkqanqdqlfqyydsltidqqqefidqlstieepaklistveqaiqfsqt
nstsrnftqlpneqtastldlskdilqnwtelglkaigngevavllmaggqgtrlgssap
kgcfnielpsqkslfqiqaekilkieqlaqqylkstkkpiinwyimtsgptrnatesffi
ennyfglnshqviffnqgtlpcfnlqgnkillelknsicqspdgngglykalkdngildd
lnskgikhihmycvdnclvkvadpifigfaiakkfdlatkvvrkrdanesvglivldqdn
qkpcvieyseisqelankkdpqdssklflraanivnhyysveflnkmipkwissqkylpf
hiakkkipslnlengefykptepngikleqfifdvfpsvelnkfgclevdrldefsplkn
adgakndtpttcrnhylersskwviqnggvidnqglvevdsktsyggeglefvngkhfkn
gdii

Sequence, based on observed residues (ATOM records): (download)

>d2yqca_ c.68.1.0 (A:) automated matches {Yeast (Candida albicans) [TaxId: 5476]}
vksqqqiidsfkqanqdqlfqyydsltidqqqefidqlstieepaklistveqaiqfsqs
rnftqlpneqtastldlskdilqnwtelglkaigngevavllmaggqgtrlgssapkgcf
nielpsqkslfqiqaekilkieqlaqqylkstkkpiinwyimtsgptrnatesffienny
fglnshqviffnqgtlpcfnlqgnkillelknsicqspdgngglykalkdngilddlnsk
gikhihmycvdnclvkvadpifigfaiakkfdlatkvvrkrdanesvglivldqdnqkpc
vieyseisqelankkdpqdssklflraanivnhyysveflnkmipkwissqkylpfhiak
kkipslnlengefykptepngikleqfifdvfpsvelnkfgclevdrldefsplknadga
kndtpttcrnhylersskwviqnggvidnqglvevdsktsyggeglefvngkhfkngdii

SCOPe Domain Coordinates for d2yqca_:

Click to download the PDB-style file with coordinates for d2yqca_.
(The format of our PDB-style files is described here.)

Timeline for d2yqca_: