Lineage for d2yloa_ (2ylo A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 923257Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 923258Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 923259Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 923994Protein automated matches [190059] (10 species)
    not a true protein
  7. 924007Species Human (Homo sapiens) [TaxId:9606] [187214] (97 PDB entries)
  8. 924147Domain d2yloa_: 2ylo A: [170855]
    automated match to d1e3ga_
    complexed with so4, tes, ylo

Details for d2yloa_

PDB Entry: 2ylo (more details), 2.5 Å

PDB Description: targeting the binding function 3 site of the androgen receptor through in silico molecular modeling
PDB Compounds: (A:) Androgen receptor

SCOPe Domain Sequences for d2yloa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yloa_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlh
vddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrh
lsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrknp
tscsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsg
kvkpiyfhtq

SCOPe Domain Coordinates for d2yloa_:

Click to download the PDB-style file with coordinates for d2yloa_.
(The format of our PDB-style files is described here.)

Timeline for d2yloa_: