SCOPe 2.05: Domain d2ylga_: 2ylg A:

Lineage for d2ylga_ (2ylg A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.3: Cytochromes [47175] (3 families)
   Heme-containing proteins

5. Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins)
   automatically mapped to Pfam PF01322

6. Protein automated matches [190363] (4 species)
   not a true protein

7. Species Achromobacter xylosoxidans [TaxId:85698] [189489] (27 PDB entries)

8. Domain d2ylga_: 2ylg A: [170854]
   automated match to d1e83a_
   complexed with asc, cmo, hec, so4

Details for d2ylga_

PDB Entry: 2ylg, 1.05 Å

PDB Description: cytochrome c prime from alcaligenes xylosoxidans: ascorbate and carbon monooxide bound l16a variant at 1.05 a resolution

PDB Compounds: (A:) cytochrome c'

SCOPe Domain Sequences for d2ylga_:

Sequence; same for both SEQRES and ATOM records:

>d2ylga_ a.24.3.2 (A:) automated matches {Achromobacter xylosoxidans [TaxId: 85698]}
efakpedavkyrqsaatlmashfgrmtpvvkgqapydaaqikanvevlktlsalpwaafg
pgteggdarpeiwsdaasfkqkqqafqdnivklsaaadagdldklraafgdvgasckach
dayrkk

Timeline for d2ylga_:

• d2ylga_ first appeared in SCOPe 2.01
  
• d2ylga_ appears in SCOPe 2.04
  
• d2ylga_ appears in SCOPe 2.06
  
• d2ylga_ appears in the current release, SCOPe 2.08