Lineage for d2ykia1 (2yki A:18-223)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
8-stranded mixed beta-sheet; 2 layers: alpha/betaSuperfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) 
Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins) 
Protein HSP90 [55876] (3 species) Species Human (Homo sapiens) [TaxId:9606] [55878] (189 PDB entries)
Uniprot P08238 10-220 # HSP 90-beta isoform ! Uniprot P07900 16-223
Domain d2ykia1: 2yki A:18-223 [170838]
Other proteins in same PDB: d2ykia2
automated match to d1uyia_
complexed with yki
Details for d2ykia1
PDB Entry: 2yki (more details), 1.67 Å
PDB Description: tricyclic series of hsp90 inhibitors
PDB Compounds: (A:) Heat shock protein HSP 90-alphaSCOPe Domain Sequences for d2ykia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ykia1 d.122.1.1 (A:18-223) HSP90 {Human (Homo sapiens) [TaxId: 9606]}
etfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgkelh
inlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfgvg
fysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqtey
leerrikeivkkhsqfigypitlfve
SCOPe Domain Coordinates for d2ykia1:
Click to download the PDB-style file with coordinates for d2ykia1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ykia1:
- d2ykia1 first appeared in SCOPe 2.01, called d2ykia_
- d2ykia1 appears in SCOPe 2.07
View in 3D
