| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) ![]() |
| Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins) |
| Protein HSP90 [55876] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [55878] (189 PDB entries) Uniprot P08238 10-220 # HSP 90-beta isoform ! Uniprot P07900 16-223 |
| Domain d2yk9a1: 2yk9 A:18-223 [170834] Other proteins in same PDB: d2yk9a2 automated match to d1uyia_ complexed with yk9 |
PDB Entry: 2yk9 (more details), 1.32 Å
SCOPe Domain Sequences for d2yk9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yk9a1 d.122.1.1 (A:18-223) HSP90 {Human (Homo sapiens) [TaxId: 9606]}
etfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgkelh
inlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfgvg
fysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqtey
leerrikeivkkhsqfigypitlfve
Timeline for d2yk9a1: