Lineage for d2yk3a_ (2yk3 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2691317Protein automated matches [190113] (17 species)
    not a true protein
  7. 2691321Species Crithidia fasciculata [TaxId:5656] [189994] (2 PDB entries)
  8. 2691325Domain d2yk3a_: 2yk3 A: [170831]
    automated match to d1hroa_
    complexed with hec, so4

Details for d2yk3a_

PDB Entry: 2yk3 (more details), 1.55 Å

PDB Description: crithidia fasciculata cytochrome c
PDB Compounds: (A:) cytochrome c

SCOPe Domain Sequences for d2yk3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yk3a_ a.3.1.1 (A:) automated matches {Crithidia fasciculata [TaxId: 5656]}
araplppgdaargeklfkgraaqchtanqggangvgpnlyglvgrhsgtiegyayskana
esgvvwtpdvldvylenpkkfmpgtkmsfagmkkpqeradviayletlkg

SCOPe Domain Coordinates for d2yk3a_:

Click to download the PDB-style file with coordinates for d2yk3a_.
(The format of our PDB-style files is described here.)

Timeline for d2yk3a_: